PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g051300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 278aa    MW: 30608.2 Da    PI: 9.4017
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g051300.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.52.4e-18119173256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Csa06g051300.1 119 RKKLRLSKEQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTK 173
                     788899***********************************************98 PP

2HD-ZIP_I/II123.88e-40119208191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     +kk+rlskeq+ +LEe+F+e+++L+p++K +la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+Lkr++d+l+een+rL+kev+eLr +l
  Csa06g051300.1 119 RKKLRLSKEQALVLEETFKEHSTLNPKQKLALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLKRCCDNLTEENRRLQKEVSELR-AL 208
                     69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046183.8E-22883IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.603.9E-1997173IPR009057Homeodomain-like
SuperFamilySSF466891.2E-18103176IPR009057Homeodomain-like
PROSITE profilePS5007117.232115175IPR001356Homeobox domain
SMARTSM003894.8E-15117179IPR001356Homeobox domain
PfamPF000467.2E-16119173IPR001356Homeobox domain
CDDcd000867.55E-15119176No hitNo description
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PfamPF021831.4E-11175209IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.9E-26175218IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MHNQINNSHP QKIHHNSWTH LFQSSGIKRT TTERNSDAGS FLRGFDVNRA ASSVVAVVNL  60
EEEAAVVSSP NSTISSVSGN KRDLAAARGG GEEHEAERAS CSHGGGSDDE DCGNGDGSRK  120
KLRLSKEQAL VLEETFKEHS TLNPKQKLAL AKQLNLRARQ VEVWFQNRRA RTKLKQTEVD  180
CEYLKRCCDN LTEENRRLQK EVSELRALKL SPHLYMHMTP PTTLTMCPSC ERVSSSSSSA  240
NVTAVLPPPA TVVGRPSPQR STPWTAISLQ QVQRSGR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117123SRKKLRL
2167175RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4935890.0AB493589.1 Arabidopsis thaliana At2g44910 mRNA for hypothetical protein, partial cds, clone: RAAt2g44910.
GenBankAJ4412510.0AJ441251.1 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein ATHB4 (Athb4 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010413054.10.0PREDICTED: homeobox-leucine zipper protein ATHB-4-like
SwissprotP929531e-153ATHB4_ARATH; Homeobox-leucine zipper protein ATHB-4
TrEMBLR0FX191e-178R0FX19_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__2679__AT2G44910.11e-163(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25772772
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44910.11e-103homeobox-leucine zipper protein 4